PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g22460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ZF-HD
Protein Properties Length: 304aa    MW: 34475.3 Da    PI: 8.3246
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g22460genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.81.1e-3295152260
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                  +++rYkeClkNhAa++Ggh++DGCgEfmps geegt + lkCaAC+CHRnFHR+e+++e
   CA02g22460  95 STIRYKECLKNHAANMGGHVLDGCGEFMPS-GEEGTREYLKCAACDCHRNFHRKETDDE 152
                  579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-2296150IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-3097149IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.4E-3098148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.3399148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.9E-30234301IPR009057Homeodomain-like
SuperFamilySSF466898.21E-19236300IPR009057Homeodomain-like
PROSITE profilePS500718.973237301IPR001356Homeobox domain
TIGRFAMsTIGR015651.7E-26239296IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEHRGQEKDM GMPNPMAYNH PSHLNQQESS SSPANKFPTA PIDDDRRTNE QIIPGNTIIS  60
PNQTLDQHNL TQTSDPDPNP VRQVSTSSAS ERNTSTIRYK ECLKNHAANM GGHVLDGCGE  120
FMPSGEEGTR EYLKCAACDC HRNFHRKETD DESQIPGMHR NNSINHRIHT QTPPSLPAAP  180
THHHHHHKYS HSYPRGHMAP VMMSFGGNSG VPAESSSEDL NMFRDGQGII QPCNFSASKK  240
RFRTKFSQQQ KDRMQEFAEK LGWRIQKQDE QEVQQFCNEV GVKRQVFKVW MHNSKQAIKK  300
KQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-212382951673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560647.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9ZPW72e-67ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLM0ZVH10.0M0ZVH1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090330.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-69homeobox protein 24